Lineage for d1auso2 (1aus O:20-147)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862680Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 862704Domain d1auso2: 1aus O:20-147 [118414]
    Other proteins in same PDB: d1ausl1, d1ausm1, d1ausn1, d1auso1, d1auss_, d1aust_, d1ausu_, d1ausv_
    duplicate of 1AUS L:20-147
    complexed with cbx, mg

Details for d1auso2

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (O:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1auso2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auso2 d.58.9.1 (O:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
ipvayvkt

SCOP Domain Coordinates for d1auso2:

Click to download the PDB-style file with coordinates for d1auso2.
(The format of our PDB-style files is described here.)

Timeline for d1auso2: