SCOPe 2.08: Domain d2bemb_: 2bem B:

Lineage for d2bemb_ (2bem B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitin-binding protein CBP21 [117045] (1 species)
   member of Pfam PF03067; elaborated fold with a large insertion between strands A and A'

7. Species Serratia marcescens [TaxId:615] [117046] (3 PDB entries)
   Uniprot O83009 28-197

8. Domain d2bemb_: 2bem B: [116699]
   complexed with edo, na, so4
   has additional subdomain(s) that are not in the common domain

Details for d2bemb_

PDB Entry: 2bem, 1.55 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21

PDB Compounds: (B:) cbp21

SCOPe Domain Sequences for d2bemb_:

Sequence; same for both SEQRES and ATOM records:

>d2bemb_ b.1.18.2 (B:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]}
hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

Timeline for d2bemb_:

• d2bemb_ first appeared in SCOP 1.71
  
• d2bemb_ appears in SCOPe 2.07