SCOPe 2.08: Domain d2belb_: 2bel B:

Lineage for d2belb_ (2bel B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
   Uniprot P28845

8. Domain d2belb_: 2bel B: [116695]
   Other proteins in same PDB: d2belc2, d2beld2
   complexed with cbo, cl, nap

Details for d2belb_

PDB Entry: 2bel, 2.11 Å

PDB Description: structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone

PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d2belb_:

Sequence; same for both SEQRES and ATOM records:

>d2belb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
frpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaasa
hyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfls
yvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsrv
nvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwttl
lirnpcrkile

Timeline for d2belb_:

• d2belb_ first appeared in SCOP 1.71
  
• d2belb_ appears in SCOPe 2.07