SCOPe 2.03: Domain d1yg5d_: 1yg5 D:

Lineage for d1yg5d_ (1yg5 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (207 PDB entries)
   Uniprot P68871

8. Domain d1yg5d_: 1yg5 D: [116685]
   Other proteins in same PDB: d1yg5a_, d1yg5c_
   complexed with hem, oxy

Details for d1yg5d_

PDB Entry: 1yg5, 2.7 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betaw37h oxy (2mm ihp, 20% peg) (10 test sets)

PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1yg5d_:

Sequence; same for both SEQRES and ATOM records:

>d1yg5d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvyphtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yg5d_:

• d1yg5d_ first appeared in SCOP 1.71
  
• d1yg5d_ appears in SCOPe 2.02
  
• d1yg5d_ appears in SCOPe 2.04
  
• d1yg5d_ appears in the current release, SCOPe 2.08