Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (207 PDB entries) Uniprot P68871 |
Domain d1ye2d_: 1ye2 D: [116643] Other proteins in same PDB: d1ye2a_, d1ye2c_ complexed with hem, oxy |
PDB Entry: 1ye2 (more details), 1.8 Å
SCOPe Domain Sequences for d1ye2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ye2d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvfpwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1ye2d_: