SCOPe 2.05: Domain d1ydwb1: 1ydw B:6-133,B:305-360

Lineage for d1ydwb1 (1ydw B:6-133,B:305-360)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Probable oxidoreductase At4g09670 [117429] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117430] (2 PDB entries)
   Uniprot Q9SZ83

8. Domain d1ydwb1: 1ydw B:6-133,B:305-360 [116626]
   Other proteins in same PDB: d1ydwa2, d1ydwb2
   Structural genomics target

Details for d1ydwb1

PDB Entry: 1ydw, 2.49 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at4g09670

PDB Compounds: (B:) AX110P-like protein

SCOPe Domain Sequences for d1ydwb1:

Sequence, based on SEQRES records:

>d1ydwb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyq
qisls

Sequence, based on observed residues (ATOM records):

>d1ydwb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefaiknngakpdgywpsisrktqlvvdavkesvdknyqqisls

Timeline for d1ydwb1:

• d1ydwb1 first appeared in SCOP 1.71
  
• d1ydwb1 appears in SCOPe 2.04
  
• d1ydwb1 appears in SCOPe 2.06
  
• d1ydwb1 appears in the current release, SCOPe 2.08