SCOP 1.71: Domain d1yavb2: 1yav B:76-144

Lineage for d1yavb2 (1yav B:76-144)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (5 proteins)
   Pfam 00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein YkuL [117881] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry)

8. Domain d1yavb2: 1yav B:76-144 [116598]
   Structural genomics target
   complexed with so4

Details for d1yavb2

PDB Entry: 1yav, 2.1 Å

PDB Description: crystal structure of cbs domain-containing protein ykul from bacillus subtilis

SCOP Domain Sequences for d1yavb2:

Sequence; same for both SEQRES and ATOM records:

>d1yavb2 d.37.1.1 (B:76-144) Hypothetical protein YkuL {Bacillus subtilis}
eriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegiftrrv
vlkelnkhi

Timeline for d1yavb2:

• d1yavb2 is new in SCOP 1.71
  
• d1yavb2 last appears in SCOP 1.73