Class a: All alpha proteins [46456] (258 folds) |
Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
Species Deinococcus radiodurans [TaxId:1299] [116763] (2 PDB entries) |
Domain d1y67d1: 1y67 D:2-89 [116502] Other proteins in same PDB: d1y67a2, d1y67b2, d1y67c2, d1y67d2 complexed with fe |
PDB Entry: 1y67 (more details), 1.85 Å
SCOP Domain Sequences for d1y67d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y67d1 a.2.11.1 (D:2-89) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld rvpadkkgalrnnagghanhsmfwqimg
Timeline for d1y67d1: