SCOP 1.73: Domain d1y1vf_: 1y1v F:

Lineage for d1y1vf_ (1y1v F:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (18 PDB entries)

8. Domain d1y1vf_: 1y1v F: [116354]

Details for d1y1vf_

PDB Entry: 1y1v, 3.8 Å

PDB Description: refined rna polymerase ii-tfiis complex

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d1y1vf_:

Sequence; same for both SEQRES and ATOM records:

>d1y1vf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d1y1vf_:

• d1y1vf_ first appeared in SCOP 1.71
  
• d1y1vf_ appears in SCOP 1.75
  
• d1y1vf_ appears in the current release, SCOPe 2.08