SCOPe 2.06: Domain d1y0eb1: 1y0e B:1-221

Lineage for d1y0eb1 (1y0e B:1-221)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam PF04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [117364] (1 PDB entry)
   Uniprot P65517

8. Domain d1y0eb1: 1y0e B:1-221 [116298]
   Other proteins in same PDB: d1y0ea2, d1y0eb2
   Structural genomics target
   complexed with po4

Details for d1y0eb1

PDB Entry: 1y0e, 1.95 Å

PDB Description: crystal structure of putative mannac-6-p epimerase from staphylococcus aureus (strain n315)

PDB Compounds: (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d1y0eb1:

Sequence; same for both SEQRES and ATOM records:

>d1y0eb1 c.1.2.5 (B:1-221) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]}
mlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvig
ivkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnve
imadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakviae
gnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme

Timeline for d1y0eb1:

• d1y0eb1 first appeared in SCOP 1.71, called d1y0eb_
  
• d1y0eb1 was called d1y0eb_ in SCOPe 2.05
  
• d1y0eb1 appears in SCOPe 2.07
  
• d1y0eb1 appears in the current release, SCOPe 2.08