Lineage for d1y0eb_ (1y0e B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570632Family c.1.2.5: NanE-like [117362] (1 protein)
    Pfam 04131
  6. 570633Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (1 species)
  7. 570634Species Staphylococcus aureus [TaxId:1280] [117364] (1 PDB entry)
  8. 570636Domain d1y0eb_: 1y0e B: [116298]
    Structural genomics target
    complexed with po4; mutant

Details for d1y0eb_

PDB Entry: 1y0e (more details), 1.95 Å

PDB Description: Crystal structure of putative ManNAc-6-P epimerase from Staphylococcus aureus (strain N315)

SCOP Domain Sequences for d1y0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0eb_ c.1.2.5 (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus}
amlphglivscqalpdeplhssfimskmalaayeggavgirantkedilaiketvdlpvi
givkrdydhsdvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnv
eimadiatveeaknaarlgfdyigttlhgytsytqgqllyqndfqflkdvlqsvdakvia
egnvitpdmykrvmdlgvhcsvvggaitrpkeitkrfvqvme

SCOP Domain Coordinates for d1y0eb_:

Click to download the PDB-style file with coordinates for d1y0eb_.
(The format of our PDB-style files is described here.)

Timeline for d1y0eb_: