SCOPe 2.01: Domain d1y01a_: 1y01 A:

Lineage for d1y01a_ (1y01 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family)
   the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)

5. Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
   this is a repeat family; one repeat unit is 1w0a A: found in domain

6. Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109754] (6 PDB entries)
   Uniprot Q9NZD4 1-94

8. Domain d1y01a_: 1y01 A: [116276]
   Other proteins in same PDB: d1y01b_
   complexed with chk, hem, oxy

Details for d1y01a_

PDB Entry: 1y01, 2.8 Å

PDB Description: crystal structure of ahsp bound to fe(ii) alpha-hemoglobin

PDB Compounds: (A:) alpha-hemoglobin stabilizing protein

SCOPe Domain Sequences for d1y01a_:

Sequence; same for both SEQRES and ATOM records:

>d1y01a_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
llkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgepqe
rdkalqelrqelntlanpflakyrdflks

Timeline for d1y01a_:

• d1y01a_ first appeared in SCOP 1.71
  
• d1y01a_ appears in SCOP 1.75
  
• d1y01a_ appears in SCOPe 2.02
  
• d1y01a_ appears in the current release, SCOPe 2.08