Lineage for d1xyga1 (1xyg A:15-162,A:327-359)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575466Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (2 species)
  7. 575467Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (1 PDB entry)
  8. 575468Domain d1xyga1: 1xyg A:15-162,A:327-359 [116221]
    Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2

Details for d1xyga1

PDB Entry: 1xyg (more details), 2.19 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g19940

SCOP Domain Sequences for d1xyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyga1 c.2.1.3 (A:15-162,A:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana)}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp

SCOP Domain Coordinates for d1xyga1:

Click to download the PDB-style file with coordinates for d1xyga1.
(The format of our PDB-style files is described here.)

Timeline for d1xyga1: