SCOP 1.73: Domain d1xxhj1: 1xxh J:208-334

Lineage for d1xxhj1 (1xxh J:208-334)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein delta prime subunit [48021] (1 species)

7. Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)

8. Domain d1xxhj1: 1xxh J:208-334 [116181]
   Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj2
   complexed with atg, po4, zn

Details for d1xxhj1

PDB Entry: 1xxh, 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

PDB Compounds: (J:) DNA polymerase III, delta prime subunit

SCOP Domain Sequences for d1xxhj1:

Sequence; same for both SEQRES and ATOM records:

>d1xxhj1 a.80.1.1 (J:208-334) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

Timeline for d1xxhj1:

• d1xxhj1 first appeared in SCOP 1.71
  
• d1xxhj1 appears in SCOP 1.75
  
• d1xxhj1 appears in the current release, SCOPe 2.08