Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.24: Type II thymidine kinase [117558] (1 protein) N-terminal part of Pfam 00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (scop_pr 52684) |
Protein Thymidine kinase, TK1, N-terminal domain [117559] (3 species) |
Species Clostridium acetobutylicum [TaxId:1488] [117562] (1 PDB entry) |
Domain d1xx6b1: 1xx6 B:2-142 [116141] Other proteins in same PDB: d1xx6a2, d1xx6b2 Structural genomics target complexed with adp, zn |
PDB Entry: 1xx6 (more details), 2 Å
SCOP Domain Sequences for d1xx6b1:
Sequence, based on SEQRES records: (download)
>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum} yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmge keqavaiknsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdfr gkpfgpipelmaiaefvdkiq
>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum} yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeavaiknsreilkyfee dteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpipelmaiaefvdk iq
Timeline for d1xx6b1: