SCOP 1.71: Domain d1xx6b1: 1xx6 B:2-142

Lineage for d1xx6b1 (1xx6 B:2-142)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.24: Type II thymidine kinase [117558] (1 protein)
   N-terminal part of Pfam 00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (scop_pr 52684)

6. Protein Thymidine kinase, TK1, N-terminal domain [117559] (3 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [117562] (1 PDB entry)

8. Domain d1xx6b1: 1xx6 B:2-142 [116141]
   Other proteins in same PDB: d1xx6a2, d1xx6b2
   Structural genomics target
   complexed with adp, zn

Details for d1xx6b1

PDB Entry: 1xx6, 2 Å

PDB Description: X-ray structure of Clostridium acetobutylicum thymidine kinase with ADP. Northeast Structural Genomics Target CAR26.

SCOP Domain Sequences for d1xx6b1:

Sequence, based on SEQRES records:

>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum}
yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmge
keqavaiknsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdfr
gkpfgpipelmaiaefvdkiq

Sequence, based on observed residues (ATOM records):

>d1xx6b1 c.37.1.24 (B:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum}
yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeavaiknsreilkyfee
dteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpipelmaiaefvdk
iq

Timeline for d1xx6b1:

• d1xx6b1 is new in SCOP 1.71
  
• d1xx6b1 appears in SCOP 1.73
  
• d1xx6b1 appears in the current release, SCOPe 2.08