SCOP 1.71: Domain d1xx2b_: 1xx2 B:

Lineage for d1xx2b_ (1xx2 B:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (8 PDB entries)

8. Domain d1xx2b_: 1xx2 B: [116137]

Details for d1xx2b_

PDB Entry: 1xx2, 1.88 Å

PDB Description: refinement of p99 beta-lactamase from enterobacter cloacae

SCOP Domain Sequences for d1xx2b_:

Sequence; same for both SEQRES and ATOM records:

>d1xx2b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

Timeline for d1xx2b_:

• d1xx2b_ is new in SCOP 1.71
  
• d1xx2b_ appears in SCOP 1.73
  
• d1xx2b_ appears in the current release, SCOPe 2.08