Lineage for d1xx2a_ (1xx2 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690268Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1690275Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (9 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 1690282Domain d1xx2a_: 1xx2 A: [116136]

Details for d1xx2a_

PDB Entry: 1xx2 (more details), 1.88 Å

PDB Description: refinement of p99 beta-lactamase from enterobacter cloacae
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1xx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx2a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOPe Domain Coordinates for d1xx2a_:

Click to download the PDB-style file with coordinates for d1xx2a_.
(The format of our PDB-style files is described here.)

Timeline for d1xx2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xx2b_