SCOPe 2.06: Domain d1xwaa1: 1xwa A:1-106

Lineage for d1xwaa1 (1xwa A:1-106)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
   Uniprot Q9V429

8. Domain d1xwaa1: 1xwa A:1-106 [116116]
   Other proteins in same PDB: d1xwaa2
   complexed with cd, cl

Details for d1xwaa1

PDB Entry: 1xwa, 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P41212

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1xwaa1:

Sequence; same for both SEQRES and ATOM records:

>d1xwaa1 c.47.1.1 (A:1-106) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

Timeline for d1xwaa1:

• d1xwaa1 first appeared in SCOP 1.71, called d1xwaa_
  
• d1xwaa1 was called d1xwaa_ in SCOPe 2.05
  
• d1xwaa1 appears in SCOPe 2.07
  
• d1xwaa1 appears in the current release, SCOPe 2.08