SCOPe 2.06: Domain d1xvya_: 1xvy A:

Lineage for d1xvya_ (1xvy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Serratia marcescens, SfuA [TaxId:615] [117743] (1 PDB entry)
   Uniprot P21408 32-338

8. Domain d1xvya_: 1xvy A: [116098]
   complexed with cit

Details for d1xvya_

PDB Entry: 1xvy, 1.74 Å

PDB Description: Crystal Structure of iron-free Serratia marcescens SfuA

PDB Compounds: (A:) sfuA

SCOPe Domain Sequences for d1xvya_:

Sequence; same for both SEQRES and ATOM records:

>d1xvya_ c.94.1.1 (A:) Ferric-binding protein FbpA {Serratia marcescens, SfuA [TaxId: 615]}
giviynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvfltensp
amvlvdnaklfapldaatlaqvepqyrpshgrwigiaarstvfvynpaklsdaqlpksll
dlakpewkgrwaaspsgadfqaivsallelkgekatlawlkamktnftaykgnstvmkav
nagqvdsgviyhyypfvdgaktgensnniklyyfkhqdpgafvsisgggvlasskhqqqa
qafikwitgkqgqeilrtnnafeyavgvgaasnpklvplkdldapkvdaaqlnskkvvel
mteagll

Timeline for d1xvya_:

• d1xvya_ first appeared in SCOP 1.71
  
• d1xvya_ appears in SCOPe 2.05
  
• d1xvya_ appears in SCOPe 2.07
  
• d1xvya_ appears in the current release, SCOPe 2.08