Lineage for d1xv9d_ (1xv9 D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097362Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 1097363Species Human (Homo sapiens) [TaxId:9606] [117016] (2 PDB entries)
    Uniprot Q14994 103-352
  8. 1097367Domain d1xv9d_: 1xv9 D: [116083]
    Other proteins in same PDB: d1xv9a_, d1xv9c_
    complexed with ci2, f15

Details for d1xv9d_

PDB Entry: 1xv9 (more details), 2.7 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid, and 5b-pregnane-3,20-dione.
PDB Compounds: (D:) Orphan nuclear receptor NR1I3

SCOPe Domain Sequences for d1xv9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xv9d_ a.123.1.1 (D:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]}
pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
lqeics

SCOPe Domain Coordinates for d1xv9d_:

Click to download the PDB-style file with coordinates for d1xv9d_.
(The format of our PDB-style files is described here.)

Timeline for d1xv9d_: