Lineage for d1xuva_ (1xuv A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040693Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
    Pfam PF05146
  6. 1040719Protein Hypothetical protein MM0500 [118095] (1 species)
  7. 1040720Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry)
    Uniprot Q8PZJ2
  8. 1040721Domain d1xuva_: 1xuv A: [116069]
    Structural genomics target

Details for d1xuva_

PDB Entry: 1xuv (more details), 2.1 Å

PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.
PDB Compounds: (A:) hypothetical protein MM0500

SCOPe Domain Sequences for d1xuva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh

SCOPe Domain Coordinates for d1xuva_:

Click to download the PDB-style file with coordinates for d1xuva_.
(The format of our PDB-style files is described here.)

Timeline for d1xuva_: