Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (6 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.5: Aha1 domain [111168] (4 proteins) Pfam 05146 |
Protein Hypothetical protein MM0500 [118095] (1 species) |
Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry) |
Domain d1xuva_: 1xuv A: [116069] |
PDB Entry: 1xuv (more details), 2.1 Å
SCOP Domain Sequences for d1xuva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei} nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh
Timeline for d1xuva_: