Lineage for d1xupx1 (1xup X:6-256)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836354Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 836355Protein Glycerol kinase [53090] (2 species)
  7. 836356Species Enterococcus casseliflavus [TaxId:37734] [117641] (2 PDB entries)
    Uniprot O34153 5-491
  8. 836363Domain d1xupx1: 1xup X:6-256 [116064]

Details for d1xupx1

PDB Entry: 1xup (more details), 2.75 Å

PDB Description: enterococcus casseliflavus glycerol kinase complexed with glycerol
PDB Compounds: (X:) glycerol kinase

SCOP Domain Sequences for d1xupx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xupx1 c.55.1.4 (X:6-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf
iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi
hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys
nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag
dqqaalfgqma

SCOP Domain Coordinates for d1xupx1:

Click to download the PDB-style file with coordinates for d1xupx1.
(The format of our PDB-style files is described here.)

Timeline for d1xupx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xupx2