Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
Protein Glycerol kinase [53090] (2 species) |
Species Enterococcus casseliflavus [TaxId:37734] [117641] (2 PDB entries) |
Domain d1xupx1: 1xup X:6-256 [116064] |
PDB Entry: 1xup (more details), 2.75 Å
SCOP Domain Sequences for d1xupx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xupx1 c.55.1.4 (X:6-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag dqqaalfgqma
Timeline for d1xupx1: