SCOP 1.71: Domain d1xupx1: 1xup X:6-256

Lineage for d1xupx1 (1xup X:6-256)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Enterococcus casseliflavus [TaxId:37734] [117641] (2 PDB entries)

8. Domain d1xupx1: 1xup X:6-256 [116064]

Details for d1xupx1

PDB Entry: 1xup, 2.75 Å

PDB Description: enterococcus casseliflavus glycerol kinase complexed with glycerol

SCOP Domain Sequences for d1xupx1:

Sequence; same for both SEQRES and ATOM records:

>d1xupx1 c.55.1.4 (X:6-256) Glycerol kinase {Enterococcus casseliflavus}
yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf
iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi
hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys
nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag
dqqaalfgqma

Timeline for d1xupx1:

• d1xupx1 is new in SCOP 1.71
  
• d1xupx1 appears in SCOP 1.73
  
• d1xupx1 appears in the current release, SCOPe 2.08