Lineage for d1xupo2 (1xup O:257-491)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701631Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 701632Protein Glycerol kinase [53090] (2 species)
  7. 701633Species Enterococcus casseliflavus [TaxId:37734] [117641] (2 PDB entries)
  8. 701639Domain d1xupo2: 1xup O:257-491 [116063]

Details for d1xupo2

PDB Entry: 1xup (more details), 2.75 Å

PDB Description: enterococcus casseliflavus glycerol kinase complexed with glycerol
PDB Compounds: (O:) glycerol kinase

SCOP Domain Sequences for d1xupo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xupo2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
fekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsaiqw
lrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttked
fvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqraan
lettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav

SCOP Domain Coordinates for d1xupo2:

Click to download the PDB-style file with coordinates for d1xupo2.
(The format of our PDB-style files is described here.)

Timeline for d1xupo2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xupo1