Lineage for d1xu7b1 (1xu7 B:24-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841402Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2841418Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
    Uniprot P28845
  8. 2841428Domain d1xu7b1: 1xu7 B:24-282 [116049]
    Other proteins in same PDB: d1xu7a2, d1xu7b2, d1xu7c2, d1xu7d2
    complexed with cps, ndp

Details for d1xu7b1

PDB Entry: 1xu7 (more details), 1.8 Å

PDB Description: crystal structure of the interface open conformation of tetrameric 11b-hsd1
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d1xu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu7b1 c.2.1.2 (B:24-282) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflyst

SCOPe Domain Coordinates for d1xu7b1:

Click to download the PDB-style file with coordinates for d1xu7b1.
(The format of our PDB-style files is described here.)

Timeline for d1xu7b1: