Lineage for d1xskf4 (1xsk F:248-585)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683562Family c.1.8.13: YicI catalytic domain-like [117372] (2 proteins)
  6. 683566Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 683567Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
  8. 683585Domain d1xskf4: 1xsk F:248-585 [115998]
    Other proteins in same PDB: d1xska1, d1xska2, d1xska3, d1xskb1, d1xskb2, d1xskb3, d1xskc1, d1xskc2, d1xskc3, d1xskd1, d1xskd2, d1xskd3, d1xske1, d1xske2, d1xske3, d1xskf1, d1xskf2, d1xskf3
    complexed with mpo, so4, xyf

Details for d1xskf4

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate
PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1xskf4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskf4 c.1.8.13 (F:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOP Domain Coordinates for d1xskf4:

Click to download the PDB-style file with coordinates for d1xskf4.
(The format of our PDB-style files is described here.)

Timeline for d1xskf4: