Lineage for d1xskc1 (1xsk C:666-773)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 570165Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 570166Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) (S)
  5. 570167Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)
  6. 570168Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 570169Species Escherichia coli [TaxId:562] [117128] (3 PDB entries)
  8. 570178Domain d1xskc1: 1xsk C:666-773 [115983]
    Other proteins in same PDB: d1xska2, d1xska3, d1xska4, d1xskb2, d1xskb3, d1xskb4, d1xskc2, d1xskc3, d1xskc4, d1xskd2, d1xskd3, d1xskd4, d1xske2, d1xske3, d1xske4, d1xskf2, d1xskf3, d1xskf4

Details for d1xskc1

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate

SCOP Domain Sequences for d1xskc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskc1 b.150.1.1 (C:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

SCOP Domain Coordinates for d1xskc1:

Click to download the PDB-style file with coordinates for d1xskc1.
(The format of our PDB-style files is described here.)

Timeline for d1xskc1: