Lineage for d1xskb2 (1xsk B:1-247)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556864Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 557152Family b.30.5.11: YicI N-terminal domain-like [117139] (1 protein)
  6. 557153Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 557154Species Escherichia coli [TaxId:562] [117141] (3 PDB entries)
  8. 557162Domain d1xskb2: 1xsk B:1-247 [115980]
    Other proteins in same PDB: d1xska1, d1xska3, d1xska4, d1xskb1, d1xskb3, d1xskb4, d1xskc1, d1xskc3, d1xskc4, d1xskd1, d1xskd3, d1xskd4, d1xske1, d1xske3, d1xske4, d1xskf1, d1xskf3, d1xskf4

Details for d1xskb2

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate

SCOP Domain Sequences for d1xskb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskb2 b.30.5.11 (B:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOP Domain Coordinates for d1xskb2:

Click to download the PDB-style file with coordinates for d1xskb2.
(The format of our PDB-style files is described here.)

Timeline for d1xskb2: