Lineage for d1xska3 (1xsk A:586-665)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566379Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 566380Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 566381Species Escherichia coli [TaxId:562] [117300] (3 PDB entries)
  8. 566388Domain d1xska3: 1xsk A:586-665 [115977]
    Other proteins in same PDB: d1xska1, d1xska2, d1xska4, d1xskb1, d1xskb2, d1xskb4, d1xskc1, d1xskc2, d1xskc4, d1xskd1, d1xskd2, d1xskd4, d1xske1, d1xske2, d1xske4, d1xskf1, d1xskf2, d1xskf4

Details for d1xska3

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate

SCOP Domain Sequences for d1xska3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xska3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOP Domain Coordinates for d1xska3:

Click to download the PDB-style file with coordinates for d1xska3.
(The format of our PDB-style files is described here.)

Timeline for d1xska3: