Lineage for d1xsjf3 (1xsj F:586-665)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566379Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 566380Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 566381Species Escherichia coli [TaxId:562] [117300] (3 PDB entries)
  8. 566399Domain d1xsjf3: 1xsj F:586-665 [115973]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjd1, d1xsjd2, d1xsjd4, d1xsje1, d1xsje2, d1xsje4, d1xsjf1, d1xsjf2, d1xsjf4
    complexed with trs

Details for d1xsjf3

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase

SCOP Domain Sequences for d1xsjf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjf3 b.71.1.4 (F:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOP Domain Coordinates for d1xsjf3:

Click to download the PDB-style file with coordinates for d1xsjf3.
(The format of our PDB-style files is described here.)

Timeline for d1xsjf3: