Lineage for d1xsjf1 (1xsj F:666-773)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565389Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 1565390Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) (S)
  5. 1565391Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)
  6. 1565392Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 1565393Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 1565405Domain d1xsjf1: 1xsj F:666-773 [115971]
    Other proteins in same PDB: d1xsja2, d1xsja3, d1xsja4, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjd2, d1xsjd3, d1xsjd4, d1xsje2, d1xsje3, d1xsje4, d1xsjf2, d1xsjf3, d1xsjf4
    complexed with trs

Details for d1xsjf1

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjf1 b.150.1.1 (F:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

SCOPe Domain Coordinates for d1xsjf1:

Click to download the PDB-style file with coordinates for d1xsjf1.
(The format of our PDB-style files is described here.)

Timeline for d1xsjf1: