![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein) |
![]() | Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117300] (3 PDB entries) |
![]() | Domain d1xsje3: 1xsj E:586-665 [115969] Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjd1, d1xsjd2, d1xsjd4, d1xsje1, d1xsje2, d1xsje4, d1xsjf1, d1xsjf2, d1xsjf4 |
PDB Entry: 1xsj (more details), 2.1 Å
SCOP Domain Sequences for d1xsje3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsje3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d1xsje3: