Class b: All beta proteins [48724] (174 folds) |
Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) |
Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d1xsib1: 1xsi B:666-773 [115931] Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsib2, d1xsib3, d1xsib4, d1xsic2, d1xsic3, d1xsic4, d1xsid2, d1xsid3, d1xsid4, d1xsie2, d1xsie3, d1xsie4, d1xsif2, d1xsif3, d1xsif4 complexed with acy, mpo, so4 |
PDB Entry: 1xsi (more details), 2.2 Å
SCOPe Domain Sequences for d1xsib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsib1 b.150.1.1 (B:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
Timeline for d1xsib1: