Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Human rhinovirus 16, HRV-16 [TaxId:31708] [111300] (2 PDB entries) Uniprot Q82122 1694-2153 |
Domain d1xr7b_: 1xr7 B: [115867] |
PDB Entry: 1xr7 (more details), 2.3 Å
SCOPe Domain Sequences for d1xr7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xr7b_ e.8.1.4 (B:) Viral RNA polymerase {Human rhinovirus 16, HRV-16 [TaxId: 31708]} gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy vtlgikkkdlinnktkdisklklaldkygvdlpmitflkdelrkkdkiaagktrvieass indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm whngpeiykdfetkirsvsagralyippyellrhewyekf
Timeline for d1xr7b_: