![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (4 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (7 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Putative hydrolase [117791] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [117792] (1 PDB entry) Uniprot Q4CCR3 |
![]() | Domain d1xqub_: 1xqu B: [115856] Structural genomics target complexed with unx |
PDB Entry: 1xqu (more details), 2.3 Å
SCOP Domain Sequences for d1xqub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqub_ d.13.1.1 (B:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil
Timeline for d1xqub_: