Lineage for d1xqub_ (1xqu B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852844Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 852845Superfamily d.13.1: HIT-like [54197] (4 families) (S)
  5. 852846Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (7 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 852896Protein Putative hydrolase [117791] (1 species)
  7. 852897Species Clostridium thermocellum [TaxId:1515] [117792] (1 PDB entry)
    Uniprot Q4CCR3
  8. 852899Domain d1xqub_: 1xqu B: [115856]
    Structural genomics target
    complexed with unx

Details for d1xqub_

PDB Entry: 1xqu (more details), 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393
PDB Compounds: (B:) HIT family hydrolase

SCOP Domain Sequences for d1xqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqub_ d.13.1.1 (B:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]}
lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi
lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil

SCOP Domain Coordinates for d1xqub_:

Click to download the PDB-style file with coordinates for d1xqub_.
(The format of our PDB-style files is described here.)

Timeline for d1xqub_: