SCOP 1.71: Domain d1xqua_: 1xqu A:

Lineage for d1xqua_ (1xqu A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (3 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (6 proteins)
   Pfam 01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Putative hydrolase [117791] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [117792] (1 PDB entry)

8. Domain d1xqua_: 1xqu A: [115855]

Details for d1xqua_

PDB Entry: 1xqu, 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393

SCOP Domain Sequences for d1xqua_:

Sequence; same for both SEQRES and ATOM records:

>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum}
lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi
lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpki

Timeline for d1xqua_:

• d1xqua_ is new in SCOP 1.71
  
• d1xqua_ appears in SCOP 1.73
  
• d1xqua_ last appears in SCOPe 2.06