Lineage for d1xq5d_ (1xq5 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531479Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (1 PDB entry)
  8. 531481Domain d1xq5d_: 1xq5 D: [115828]
    Other proteins in same PDB: d1xq5a_, d1xq5c_
    Structural genomics target
    complexed with ace, hem

Details for d1xq5d_

PDB Entry: 1xq5 (more details), 1.9 Å

PDB Description: Met-Perch Hemoglobin at 1.9A

SCOP Domain Sequences for d1xq5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq5d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens)}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOP Domain Coordinates for d1xq5d_:

Click to download the PDB-style file with coordinates for d1xq5d_.
(The format of our PDB-style files is described here.)

Timeline for d1xq5d_: