SCOP 1.71: Domain d1xq5a_: 1xq5 A:

Lineage for d1xq5a_ (1xq5 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Yellow perch (Perca flavescens) [TaxId:8167] [116749] (1 PDB entry)

8. Domain d1xq5a_: 1xq5 A: [115825]
   Other proteins in same PDB: d1xq5b_, d1xq5d_

Details for d1xq5a_

PDB Entry: 1xq5, 1.9 Å

PDB Description: Met-Perch Hemoglobin at 1.9A

SCOP Domain Sequences for d1xq5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens)}
slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
evhisydkffsalaralaekyr

Timeline for d1xq5a_:

• d1xq5a_ is new in SCOP 1.71
  
• d1xq5a_ appears in SCOP 1.73
  
• d1xq5a_ appears in the current release, SCOPe 2.08