Lineage for d1xpra3 (1xpr A:129-417)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848361Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 1848362Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
    Uniprot P03002
  8. 1848375Domain d1xpra3: 1xpr A:129-417 [115774]
    Other proteins in same PDB: d1xpra1, d1xpra2, d1xprb1, d1xprb2, d1xprc1, d1xprc2, d1xprd1, d1xprd2, d1xpre1, d1xpre2, d1xprf1, d1xprf2
    protein/RNA complex; complexed with ags, fb, mg

Details for d1xpra3

PDB Entry: 1xpr (more details), 3.15 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
PDB Compounds: (A:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpra3:

Sequence, based on SEQRES records: (download)

>d1xpra3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1xpra3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti
iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe
elqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOPe Domain Coordinates for d1xpra3:

Click to download the PDB-style file with coordinates for d1xpra3.
(The format of our PDB-style files is described here.)

Timeline for d1xpra3: