Lineage for d1xpca_ (1xpc A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923341Protein Estrogen receptor alpha [48519] (1 species)
  7. 923342Species Human (Homo sapiens) [TaxId:9606] [48520] (57 PDB entries)
    Uniprot P03372 307-551
  8. 923345Domain d1xpca_: 1xpc A: [115738]
    complexed with ait

Details for d1xpca_

PDB Entry: 1xpc (more details), 1.6 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with compound 19
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d1xpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
hrlha

SCOPe Domain Coordinates for d1xpca_:

Click to download the PDB-style file with coordinates for d1xpca_.
(The format of our PDB-style files is described here.)

Timeline for d1xpca_: