SCOPe 2.05: Domain d1xp8a2: 1xp8 A:283-341

Lineage for d1xp8a2 (1xp8 A:283-341)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families)

5. Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)

6. Protein RecA protein, C-terminal domain [54754] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [117900] (1 PDB entry)
   Uniprot P42443 15-341

8. Domain d1xp8a2: 1xp8 A:283-341 [115736]
   Other proteins in same PDB: d1xp8a1
   protein/DNA complex; complexed with ags

Details for d1xp8a2

PDB Entry: 1xp8, 2.5 Å

PDB Description: deinococcus radiodurans reca in complex with atp-gamma-s

PDB Compounds: (A:) reca protein

SCOPe Domain Sequences for d1xp8a2:

Sequence; same for both SEQRES and ATOM records:

>d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
qlsdlvglaadmdiikkagsfysygderigqgkektiayiaerpemeqeirdrvmaair

Timeline for d1xp8a2:

• d1xp8a2 first appeared in SCOP 1.71
  
• d1xp8a2 appears in SCOPe 2.04
  
• d1xp8a2 appears in SCOPe 2.06
  
• d1xp8a2 appears in the current release, SCOPe 2.08