SCOPe 2.08: Domain d1xp5a3: 1xp5 A:361-599

Lineage for d1xp5a3 (1xp5 A:361-599)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries)
   Uniprot P04191

8. Domain d1xp5a3: 1xp5 A:361-599 [115732]
   Other proteins in same PDB: d1xp5a1, d1xp5a2, d1xp5a4
   complexed with alf, k, mg, tg1
   has additional insertions and/or extensions that are not grouped together

Details for d1xp5a3

PDB Entry: 1xp5, 3 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1xp5a3:

Sequence; same for both SEQRES and ATOM records:

>d1xp5a3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d1xp5a3:

• d1xp5a3 first appeared in SCOP 1.71
  
• d1xp5a3 appears in SCOPe 2.07