Lineage for d1xp1a_ (1xp1 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776564Domain d1xp1a_: 1xp1 A: [115721]
    complexed with aih

Details for d1xp1a_

PDB Entry: 1xp1 (more details), 1.8 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with compound 15
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d1xp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp1a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
hrlha

SCOP Domain Coordinates for d1xp1a_:

Click to download the PDB-style file with coordinates for d1xp1a_.
(The format of our PDB-style files is described here.)

Timeline for d1xp1a_: