Lineage for d1xp0a_ (1xp0 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651168Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 651283Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 651284Species Human (Homo sapiens) [TaxId:9606] [101440] (13 PDB entries)
  8. 651288Domain d1xp0a_: 1xp0 A: [115720]
    complexed with mg, vdn, zn

Details for d1xp0a_

PDB Entry: 1xp0 (more details), 1.79 Å

PDB Description: catalytic domain of human phosphodiesterase 5a in complex with vardenafil
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOP Domain Sequences for d1xp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp0a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
thvsedcfplldgcrknrqkwqalae

SCOP Domain Coordinates for d1xp0a_:

Click to download the PDB-style file with coordinates for d1xp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xp0a_: