SCOPe 2.02: Domain d1xo3a_: 1xo3 A:

Lineage for d1xo3a_ (1xo3 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.3: C9orf74 homolog [117833] (1 protein)

6. Protein C9orf74 homolog [117834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries)
   Uniprot Q9D2P4 #

8. Domain d1xo3a_: 1xo3 A: [115678]
   Structural genomics target

Details for d1xo3a_

PDB Entry: 1xo3

PDB Description: solution structure of ubiquitin like protein from mus musculus

PDB Compounds: (A:) RIKEN cDNA 2900073H19

SCOPe Domain Sequences for d1xo3a_:

Sequence; same for both SEQRES and ATOM records:

>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]}
saaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqg
dsvrpgilvlindadwellgeldyqlqdqdsilfistlhgg

Timeline for d1xo3a_:

• d1xo3a_ first appeared in SCOP 1.71
  
• d1xo3a_ appears in SCOPe 2.01
  
• d1xo3a_ appears in SCOPe 2.03
  
• d1xo3a_ appears in the current release, SCOPe 2.08, called d1xo3a1