SCOPe 2.01: Domain d1xo0a2: 1xo0 A:130-341

Lineage for d1xo0a2 (1xo0 A:130-341)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1xo0a2: 1xo0 A:130-341 [115675]
   Other proteins in same PDB: d1xo0a1, d1xo0b1
   protein/DNA complex

Details for d1xo0a2

PDB Entry: 1xo0, 2 Å

PDB Description: high resolution structure of the holliday junction intermediate in cre-loxp site-specific recombination

PDB Compounds: (A:) Recombinase cre

SCOPe Domain Sequences for d1xo0a2:

Sequence; same for both SEQRES and ATOM records:

>d1xo0a2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d1xo0a2:

• d1xo0a2 first appeared in SCOP 1.71
  
• d1xo0a2 appears in SCOP 1.75
  
• d1xo0a2 appears in SCOPe 2.02
  
• d1xo0a2 appears in the current release, SCOPe 2.08