| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
| Domain d1xnrs_: 1xnr S: [115644] Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrt_, d1xnrv_ complexed with mg, par, zn |
PDB Entry: 1xnr (more details), 3.1 Å
SCOPe Domain Sequences for d1xnrs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnrs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d1xnrs_: