SCOPe 2.03: Domain d1xnrs_: 1xnr S:

Lineage for d1xnrs_ (1xnr S:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1xnrs_: 1xnr S: [115644]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnrs_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

PDB Compounds: (S:) 16S Ribosomal protein S19

SCOPe Domain Sequences for d1xnrs_:

Sequence; same for both SEQRES and ATOM records:

>d1xnrs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1xnrs_:

• d1xnrs_ first appeared in SCOP 1.71
  
• d1xnrs_ appears in SCOPe 2.02
  
• d1xnrs_ appears in SCOPe 2.04
  
• d1xnrs_ appears in the current release, SCOPe 2.08